PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g11130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 302aa    MW: 33687.8 Da    PI: 10.011
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g11130genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.93.3e-19221255135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                C++C t kTp+WR+gp+g+ktLCnaCG+++r+ +l
  Tp4g11130 221 CTHCATVKTPQWREGPSGPKTLCNACGVRFRSGRL 255
                *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.7E-18215269IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.1E-14219252IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.19E-14219278No hitNo description
PROSITE profilePS5011411.833219251IPR000679Zinc finger, GATA-type
CDDcd002022.61E-16220271No hitNo description
PfamPF003205.5E-17221255IPR000679Zinc finger, GATA-type
PROSITE patternPS003440221246IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MNNGSWLPEE DFKGLSDNFF DDLINHIDFP LEDIETTNDE GDWDAEFKNL VPPPLDLLTS  60
LSSEFTRGSS TCKGQRAGVQ KKPVPVLKQT SSSEVSSTVD SSLPDVKVLK LFQSSSPVSV  120
LENANGSASF QNPNRAQRLA FPVKGIRSKR KRPTTLRFRS LKSFASEMSQ LFAPDESSDS  180
ESYLSSEDSA KKKRKKNKNR AAHSVSQSPE PFNPDGTIRK CTHCATVKTP QWREGPSGPK  240
TLCNACGVRF RSGRLLPEYR PASSPTFIPT MHSNSHRKII EMRRNDEVKF ETAMTRSVRS  300
RG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191195KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006409859.11e-162hypothetical protein EUTSA_v10017012mg
SwissprotQ6DBP81e-118GAT11_ARATH; GATA transcription factor 11
TrEMBLV4M8B91e-162V4M8B9_EUTSA; Uncharacterized protein
STRINGscaffold_401176.11e-144(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-95GATA transcription factor 11